Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
- Loading branch information
Showing
39 changed files
with
487,407 additions
and
13,239 deletions.
There are no files selected for viewing
Large diffs are not rendered by default.
Oops, something went wrong.
Large diffs are not rendered by default.
Oops, something went wrong.
Large diffs are not rendered by default.
Oops, something went wrong.
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,2 @@ | ||
download link on 28/07/20 | ||
https://www.uniprot.org/proteomes/UP000000589 |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,15 @@ | ||
>BACE1-BirA fusion protein DNA sequence | ||
MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFV | ||
EMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYR | ||
DLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLA | ||
YAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSL | ||
YTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAA | ||
VKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQY | ||
LRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFR | ||
TAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQWRCLRCLRQ | ||
QHDDFADDISLLKGGSGGSKDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTL | ||
RDWGVDVFTVPGKGYSLPEPIQLLNAKQILGQLDGGSVAVLPVIDSTNQYLLDRIGELKSG | ||
DACIAEYQQAGRGGRGRKWFSPFGANLYLSMFWRLEQGPAAAIGLSLVIGIVMAEVLRKLG | ||
ADKVRVKWPNDLYLQDRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQGWITL | ||
QEAGINLDRNTLAAMLIRELRAALELFEQEGLAPYLSRWEKLDNFINRPVKLIIGDKEIFG | ||
ISRGIDKQGALLLEQDGIIKPWMGGEISLRSAEKA |
471,955 changes: 471,955 additions & 0 deletions
471,955
database/uniprot-proteome UP000000589.fasta
Large diffs are not rendered by default.
Oops, something went wrong.
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
Large diffs are not rendered by default.
Oops, something went wrong.
Large diffs are not rendered by default.
Oops, something went wrong.
Large diffs are not rendered by default.
Oops, something went wrong.
Large diffs are not rendered by default.
Oops, something went wrong.
Binary file not shown.
Large diffs are not rendered by default.
Oops, something went wrong.
Large diffs are not rendered by default.
Oops, something went wrong.
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -1,61 +1,51 @@ | ||
# list of 60 proteins with FDR <= 0.1 (FDR values computed using 100 bootstrap realizations of the data) | ||
BACE1-BirA | ||
# list of 50 proteins with FDR <= 0.1 (FDR values computed using 100 bootstrap realizations of the data) | ||
sp|Q80UU9|PGRC2_MOUSE | ||
BACE1-BirA | ||
sp|P49817|CAV1_MOUSE | ||
sp|Q9CQW9|IFM3_MOUSE | ||
sp|P63024|VAMP3_MOUSE | ||
sp|Q9CQW1|YKT6_MOUSE | ||
tr|A0A0R4J1G9|A0A0R4J1G9_MOUSE | ||
tr|A0A0J9YTY0|A0A0J9YTY0_MOUSE | ||
sp|O54724|CAVN1_MOUSE | ||
tr|A0A0R4J1G9|A0A0R4J1G9_MOUSE | ||
sp|O09044|SNP23_MOUSE | ||
tr|F7DBB3|F7DBB3_MOUSE | ||
tr|E9Q616|E9Q616_MOUSE | ||
sp|Q5Y5T1|ZDH20_MOUSE | ||
sp|O54724|CAVN1_MOUSE | ||
tr|D3YVM2|D3YVM2_MOUSE | ||
sp|Q5Y5T1|ZDH20_MOUSE | ||
sp|Q811D0|DLG1_MOUSE | ||
tr|A0A140LIU9|A0A140LIU9_MOUSE | ||
sp|Q80Z96|VANG1_MOUSE | ||
sp|Q6P9J9|ANO6_MOUSE | ||
sp|Q63918|CAVN2_MOUSE | ||
sp|O54962|BAF_MOUSE | ||
sp|P47738|ALDH2_MOUSE | ||
sp|Q3UL36|ARGL1_MOUSE | ||
tr|Q924U4|Q924U4_MOUSE | ||
sp|Q03145|EPHA2_MOUSE | ||
sp|P18572|BASI_MOUSE | ||
sp|Q62371|DDR2_MOUSE | ||
sp|P47738|ALDH2_MOUSE | ||
tr|E9Q9C3|E9Q9C3_MOUSE | ||
sp|O54962|BAF_MOUSE | ||
tr|A0A1B0GRR3|A0A1B0GRR3_MOUSE | ||
tr|A0A0A0MQM0|A0A0A0MQM0_MOUSE | ||
sp|Q3T9E4|TGTP2_MOUSE | ||
tr|E9Q616|E9Q616_MOUSE | ||
sp|Q8CIB5|FERM2_MOUSE | ||
sp|P43275|H11_MOUSE | ||
sp|Q62371|DDR2_MOUSE | ||
sp|P23242|CXA1_MOUSE | ||
sp|P50544|ACADV_MOUSE | ||
tr|Q9ESU7|Q9ESU7_MOUSE | ||
tr|E9Q9C3|E9Q9C3_MOUSE | ||
tr|A0A0A0MQM0|A0A0A0MQM0_MOUSE | ||
tr|Q3UXD9|Q3UXD9_MOUSE | ||
tr|A0A338P6B4|A0A338P6B4_MOUSE | ||
sp|Q8CIB5|FERM2_MOUSE | ||
sp|P45952|ACADM_MOUSE | ||
sp|Q08509|EPS8_MOUSE | ||
sp|P50544|ACADV_MOUSE | ||
sp|P23242|CXA1_MOUSE | ||
tr|E9Q3N1|E9Q3N1_MOUSE | ||
sp|Q8JZM0|TFB1M_MOUSE | ||
sp|Q8C0J6|SWAHC_MOUSE | ||
sp|Q8VCR7|ABHEB_MOUSE | ||
tr|F8WHG5|F8WHG5_MOUSE | ||
sp|Q922W5|P5CR1_MOUSE | ||
sp|P47962|RL5_MOUSE | ||
sp|P70453|PDE7A_MOUSE | ||
sp|P45952|ACADM_MOUSE | ||
tr|Q8VCV2|Q8VCV2_MOUSE | ||
tr|A0A498WFS2|A0A498WFS2_MOUSE | ||
tr|A2A6U3|A2A6U3_MOUSE | ||
tr|F8WHG5|F8WHG5_MOUSE | ||
sp|Q6ZQI3|MLEC_MOUSE | ||
sp|P10922|H10_MOUSE | ||
sp|Q99JR1|SFXN1_MOUSE | ||
tr|Q3UXD9|Q3UXD9_MOUSE | ||
sp|Q9CQU0|TXD12_MOUSE | ||
tr|E9Q3N1|E9Q3N1_MOUSE | ||
tr|V9GXA5|V9GXA5_MOUSE | ||
sp|Q04750|TOP1_MOUSE | ||
sp|Q8BKX1|BAIP2_MOUSE | ||
sp|Q3THW5|H2AV_MOUSE | ||
sp|Q9CZE3|RAB32_MOUSE | ||
tr|A2A6U3|A2A6U3_MOUSE | ||
sp|Q91YT8|CSCL1_MOUSE | ||
sp|P0CL69|ZN703_MOUSE | ||
sp|Q9EQ06|DHB11_MOUSE | ||
sp|Q9JHS4|CLPX_MOUSE | ||
sp|Q02013|AQP1_MOUSE | ||
sp|Q62093|SRSF2_MOUSE | ||
tr|A2ACM0|A2ACM0_MOUSE |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -1,38 +1,33 @@ | ||
# list of 37 proteins with FDR <= 0.1 (FDR values computed using 100 bootstrap realizations of the data) | ||
# list of 32 proteins with FDR <= 0.1 (FDR values computed using 100 bootstrap realizations of the data) | ||
sp|Q80UU9|PGRC2_MOUSE | ||
sp|P49817|CAV1_MOUSE | ||
sp|Q9CQW1|YKT6_MOUSE | ||
sp|P63024|VAMP3_MOUSE | ||
BACE1-BirA | ||
sp|O54724|CAVN1_MOUSE | ||
sp|P49817|CAV1_MOUSE | ||
sp|Q9CQW9|IFM3_MOUSE | ||
tr|A0A0J9YTY0|A0A0J9YTY0_MOUSE | ||
BACE1-BirA | ||
sp|O54724|CAVN1_MOUSE | ||
tr|A0A0R4J1G9|A0A0R4J1G9_MOUSE | ||
sp|P18572|BASI_MOUSE | ||
sp|Q811D0|DLG1_MOUSE | ||
sp|Q08509|EPS8_MOUSE | ||
sp|O09044|SNP23_MOUSE | ||
tr|E9Q616|E9Q616_MOUSE | ||
sp|Q5Y5T1|ZDH20_MOUSE | ||
tr|F7DBB3|F7DBB3_MOUSE | ||
sp|Q8BVY0|RL1D1_MOUSE | ||
tr|A2A6U3|A2A6U3_MOUSE | ||
tr|A0A494BAX5|A0A494BAX5_MOUSE | ||
sp|Q9WVA4|TAGL2_MOUSE | ||
sp|Q99JR1|SFXN1_MOUSE | ||
sp|Q8CIB5|FERM2_MOUSE | ||
sp|Q8C3W1|CA198_MOUSE | ||
sp|Q03145|EPHA2_MOUSE | ||
sp|Q80Z96|VANG1_MOUSE | ||
tr|A0A2U3TZ82|A0A2U3TZ82_MOUSE | ||
tr|E9Q9C3|E9Q9C3_MOUSE | ||
tr|Q9ESU7|Q9ESU7_MOUSE | ||
tr|Q3TQ29|Q3TQ29_MOUSE | ||
sp|Q61768|KINH_MOUSE | ||
sp|Q62371|DDR2_MOUSE | ||
sp|Q5F2E8|TAOK1_MOUSE | ||
tr|E9Q9C3|E9Q9C3_MOUSE | ||
sp|Q8VIG0|ZCH14_MOUSE | ||
sp|P08752|GNAI2_MOUSE | ||
sp|Q61768|KINH_MOUSE | ||
sp|Q8BVY0|RL1D1_MOUSE | ||
tr|E9Q616|E9Q616_MOUSE | ||
tr|E9QM38|E9QM38_MOUSE | ||
sp|Q8VDP4|CCAR2_MOUSE | ||
sp|P47962|RL5_MOUSE | ||
tr|A0A494BAX5|A0A494BAX5_MOUSE | ||
sp|Q99JR1|SFXN1_MOUSE | ||
sp|Q8R326|PSPC1_MOUSE | ||
sp|Q8C3W1|CA198_MOUSE | ||
sp|P08752|GNAI2_MOUSE |
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.