seance6_croisement/slides.html

<!DOCTYPE html>
<html lang="" xml:lang="">
  <head>
    <title>Croisement de données</title>
    <meta charset="utf-8" />
    <meta name="author" content="Olivier Rué - Matthias Zytnicki" />
    <meta name="date" content="2021-03-25" />
    <script src="slides_files/header-attrs/header-attrs.js"></script>
    <link href="slides_files/remark-css/default.css" rel="stylesheet" />
    <link href="slides_files/remark-css/default-fonts.css" rel="stylesheet" />
    <link rel="stylesheet" href="css/styles.css" type="text/css" />
  </head>
  <body>
    <textarea id="source">
class: center, middle, inverse, title-slide

# Croisement de données
## DUBii - Module 5
### Olivier Rué - Matthias Zytnicki
### 2021-03-25

---


# Programme


- Présentation des intervenants, organisation

- Rappel sur les formats de fichiers

- &lt;strong class="tool"&gt;Bedtools&lt;/strong&gt; &lt;a id='cite-quinlan2010bedtools'&gt;&lt;/a&gt;(&lt;a href='#bib-quinlan2010bedtools'&gt;Quinlan and Hall, 2010&lt;/a&gt;)

- TP en mode distanciation sociale

.center[
![](images/formation-a-distance.jpeg)
]

---

# Rappels sur les formats de fichiers

Format  | Contenu
------------- | -------------
FASTA  | ?
FASTQ  | ?
SAM/BAM  | ?
BED/GTF/GFF  | ?
VCF  | ? 

---

# Rappels sur les formats de fichiers

Format  | Contenu
------------- | -------------
FASTA  | Information de séquence
FASTQ  | Séquence et qualité de lectures provenant d'un séquençage
SAM/BAM  | Alignement des lectures sur une référence
BED/GTF/GFF  | Coordonnées et annotations génomiques
VCF  | Coordonnées et annotations des variants génomiques 

---

## FASTA

```bash
&gt;foo
ATGCC
&gt;bar other optional text could go here
CCGTA
&gt;bidou
ACTGCAGT
TTCGN
&gt;repeatmasker
ATGTGTcggggggATTTT
&gt;prot2; my_favourite_prot
MTSRRSVKSGPREVPRDEYEDLYYTPSSGMASP
```

## FASTQ

```bash
@SEQ_ID
GATTTGGGGTTCAAAGCAGTATCGATCAAATAGTAAATCCATTTGTTCAACTCACAGTTT
+
!''*((((***+))%%%++)(%%%%).1***-+*''))**55CCF&gt;&gt;&gt;&gt;&gt;&gt;CCCCCCC65
```
---

## SAM/BAM

- _Sequence Alignment Map_

- Contient les informations des alignements des lectures sur le génome

- 2 sections
  - le header
  - les alignements

- Se manipule avec 
  - &lt;strong class="tool"&gt;samtools&lt;/strong&gt; &lt;a id='cite-samtools'&gt;&lt;/a&gt;(&lt;a href='#bib-samtools'&gt;Li, Handsaker, Wysoker, Fennell, Ruan, Homer, Marth, Abecasis, and Durbin, 2009&lt;/a&gt;),
  - &lt;strong class="tool"&gt;bedtools&lt;/strong&gt; (&lt;a href='#bib-quinlan2010bedtools'&gt;Quinlan and Hall, 2010&lt;/a&gt;),
  - &lt;strong class="tool"&gt;Picard tools&lt;/strong&gt; &lt;a id='cite-picardtools'&gt;&lt;/a&gt;(&lt;a href='#bib-picardtools'&gt;Broad Institute, 2018&lt;/a&gt;),
  - ...

- Toujours travailler avec le BAM, trié et indexé

---

## SAM/BAM


&lt;img src="images/SAM_format.jpg" width="80%" style="display: block; margin: auto;" /&gt;


---

## BED

- _Browser Extensible Data_

- Ce sont des formats "d'intervalles". Chaque ligne contient un intervalle de coordonnées génomiques avec au minimum 3 colonnes :


```bash
# BED 3 columns
#chromosome  start  end
chr1  145  200
chr1  345  500
chr1  600  1000
```

- Plus d'informations avec 6 colonnes :
  

```bash
# BED 6 columns
#chromosome  start  end  name  score  strand
chr1  145  200  i1  0  +
chr1  345  500  i2  0  +
chr1  600  1000  i3  0  +
```


---

## BED

&lt;img src="images/BED_format.png" width="100%" style="display: block; margin: auto;" /&gt;

---

## GFF

- _General Feature Format_

- GFF puis GFF2 puis GFF3

- GFF3 actuellement en vigueur : &lt;a href="http://gmod.org/wiki/GFF3"&gt;documentation&lt;/a&gt;

- Format utilisé pour localiser et décrire toute zone caractéristique d'un génome (ex : un exon)

- Un header


```bash
##gff-version 3
```

- 9 colonnes décrivant des *features*


```bash
ctg123 . mRNA            1300  9000  .  +  .  ID=mrna0001;Name=sonichedgehog
ctg123 . exon            1300  1500  .  +  .  ID=exon00001;Parent=mrna0001
ctg123 . exon            1050  1500  .  +  .  ID=exon00002;Parent=mrna0001
ctg123 . exon            3000  3902  .  +  .  ID=exon00003;Parent=mrna0001
ctg123 . exon            5000  5500  .  +  .  ID=exon00004;Parent=mrna0001
ctg123 . exon            7000  9000  .  +  .  ID=exon00005;Parent=mrna0001
```

---

## GFF3

1. seqid - Nom du chromosome ou scaffold
2. source - Nom du programme utilisé pour générer ce fichier
3. type - Type d'élément (feature). Doit correspondre à l'ontologie &lt;a href="http://www.sequenceontology.org/so_wiki/index.php/Category:SO:SOFA"&gt;SOFA&lt;/a&gt; &lt;a id='cite-eilbeck2005sequence'&gt;&lt;/a&gt;(&lt;a href='#bib-eilbeck2005sequence'&gt;Eilbeck, Lewis, Mungall, Yandell, Stein, Durbin, and Ashburner, 2005&lt;/a&gt;)
4. start - Début (1-based)
5. end - Fin
6. score - Score décimal
7. strand - Brin + (forward) ou - (reverse).
8. phase - Phase : 0, 1 ou 2 (base du codon)
9. attributes - Liste de paires tag-valeur, par exemple ID, Name, Alias, Parent...


```bash
#seqid source type  start  end   score  strand  phase  attributes
ctg123 .      mRNA  1300   9000  .      +       .      ID=mrna0001;Name=bidou;Parent=gene001
```

---

## GTF

- Dérivé du GFF
- 8 premières colonnes identiques
- La 9ème (attributes) doit contenir gene_id ou transcript_id
- Spécialisé dans l'annotation des gènes
  - gene_id obligatoire
  - transcript_id obligatoire
- GTF == GFF2


```bash
chr1	Cufflinks	transcript	62948	63887	1000	+	.	gene_id "ENSG00000240361"; transcript_id "ENST00000492842"; FPKM "0.1133032705"; frac "1.596713"; conf_lo "0.000000"; conf_hi "0.312052"; cov "0.351936"; full_read_support "yes";
```

--

&lt;div class="alert danger"&gt;Attention au parsing du GTF, il y a des espaces dans la 9ème colonne !&lt;/div&gt;

---

## VCF

- _Variant Calling Format_

- En migration vers _gVCF_ ()

- Header décrivant le format et l'obtention du fichier

- Une ligne par variant (SNV, INSERTION, DELETION...)

---

## VCF

&lt;img src="images/VCF_format.png" width="100%" style="display: block; margin: auto;" /&gt;

---

## Système de coordonnées


.pull-left[
0-based:


```bash
ACTGACTG
012345678
```

- BED
- BAM

]

.pull-right[
1-based:


```bash
ACTGACTG
12345678
```

- GTF
- GFF
- SAM
- VCF

]

--

&lt;div class="alert comment"&gt;Les outils font automatiquement la conversion, attention si vous cherchez l'information directement !&lt;/div&gt;
---

## BEDTOOLS

- Le couteau suisse pour travailler sur des fichiers d'intervalles et croiser différents types de données

- Permet de nombreuses manipulations et croisement sur :
  - BAM
  - BED
  - GFF/GTF
  - VCF

.pull-left[
![](images/bedtools_logo.png)
]
.pull-right[
- Documentation : https://bedtools.readthedocs.io/en/latest/
- Tutoriel : http://quinlanlab.org/tutorials/bedtools/bedtools.html
]

---

## Une super documentation !

- Avec des schémas

&lt;img src="images/bedtools_intersect.png" width="30%" style="display: block; margin: auto;" /&gt;

- Une documentation complète

- De nombreux exemples

&lt;a href="https://bedtools.readthedocs.io/en/latest/content/tools/intersect.html"&gt;Exemple pour l'outil intersect&lt;/a&gt;

---

## Performance

- Pas de multithreading avec Bedtools
- Sur de gros jeux de données, il faut que les fichiers soient triés (de la même manière bien sûr)

&lt;img src="images/bedtools_time.png" width="30%" style="display: block; margin: auto;" /&gt;

---

## TP : Données à croiser

.pull-left[
* Génome humain : &lt;code&gt;FASTA&lt;/code&gt;
* Annotation : &lt;code&gt;GFF3&lt;/code&gt;
* Variants : &lt;code&gt;VCF&lt;/code&gt;
* Alignements : &lt;code&gt;BAM&lt;/code&gt;
* Transcrits : &lt;code&gt;GTF&lt;/code&gt;
]

.pull-right[
&lt;img src="images/croisement.jpg" width="60%" style="display: block; margin: auto;" /&gt;
]

--

Ce &lt;a href="https://du-bii.github.io/module-5-Methodes-Outils/seance4/document.html"&gt;document&lt;/a&gt; vous permettra de suivre pas à pas le TP associé à la suite BEDtools

&lt;img src="images/Charge-mentale-1__1_.jpg" width="30%" style="display: block; margin: auto;" /&gt;

---

# References

&lt;p&gt;&lt;cite&gt;&lt;a id='bib-picardtools'&gt;&lt;/a&gt;&lt;a href="#cite-picardtools"&gt;Broad Institute&lt;/a&gt;
(2018).
&lt;em&gt;Picard Tools&lt;/em&gt;.
&lt;a href="http://broadinstitute.github.io/picard/"&gt;http://broadinstitute.github.io/picard/&lt;/a&gt;.&lt;/cite&gt;&lt;/p&gt;

&lt;p&gt;&lt;cite&gt;&lt;a id='bib-eilbeck2005sequence'&gt;&lt;/a&gt;&lt;a href="#cite-eilbeck2005sequence"&gt;Eilbeck, K., S. E. Lewis, C. J. Mungall, et al.&lt;/a&gt;
(2005).
&amp;ldquo;The Sequence Ontology: a tool for the unification of genome annotations&amp;rdquo;.
In: &lt;em&gt;Genome biology&lt;/em&gt; 6.5, p. R44.&lt;/cite&gt;&lt;/p&gt;

&lt;p&gt;&lt;cite&gt;&lt;a id='bib-samtools'&gt;&lt;/a&gt;&lt;a href="#cite-samtools"&gt;Li, H., B. Handsaker, A. Wysoker, et al.&lt;/a&gt;
(2009).
&amp;ldquo;The sequence alignment/map format and SAMtools&amp;rdquo;.
In: &lt;em&gt;Bioinformatics&lt;/em&gt; 25.16, pp. 2078&amp;ndash;2079.&lt;/cite&gt;&lt;/p&gt;

&lt;p&gt;&lt;cite&gt;&lt;a id='bib-quinlan2010bedtools'&gt;&lt;/a&gt;&lt;a href="#cite-quinlan2010bedtools"&gt;Quinlan, A. R. and I. M. Hall&lt;/a&gt;
(2010).
&amp;ldquo;BEDTools: a flexible suite of utilities for comparing genomic features&amp;rdquo;.
In: &lt;em&gt;Bioinformatics&lt;/em&gt; 26.6, pp. 841&amp;ndash;842.&lt;/cite&gt;&lt;/p&gt;
    </textarea>
<style data-target="print-only">@media screen {.remark-slide-container{display:block;}.remark-slide-scaler{box-shadow:none;}}</style>
<script src="https://remarkjs.com/downloads/remark-latest.min.js"></script>
<script>var slideshow = remark.create({
"ratio": "16:9"
});
if (window.HTMLWidgets) slideshow.on('afterShowSlide', function (slide) {
  window.dispatchEvent(new Event('resize'));
});
(function(d) {
  var s = d.createElement("style"), r = d.querySelector(".remark-slide-scaler");
  if (!r) return;
  s.type = "text/css"; s.innerHTML = "@page {size: " + r.style.width + " " + r.style.height +"; }";
  d.head.appendChild(s);
})(document);

(function(d) {
  var el = d.getElementsByClassName("remark-slides-area");
  if (!el) return;
  var slide, slides = slideshow.getSlides(), els = el[0].children;
  for (var i = 1; i < slides.length; i++) {
    slide = slides[i];
    if (slide.properties.continued === "true" || slide.properties.count === "false") {
      els[i - 1].className += ' has-continuation';
    }
  }
  var s = d.createElement("style");
  s.type = "text/css"; s.innerHTML = "@media print { .has-continuation { display: none; } }";
  d.head.appendChild(s);
})(document);
// delete the temporary CSS (for displaying all slides initially) when the user
// starts to view slides
(function() {
  var deleted = false;
  slideshow.on('beforeShowSlide', function(slide) {
    if (deleted) return;
    var sheets = document.styleSheets, node;
    for (var i = 0; i < sheets.length; i++) {
      node = sheets[i].ownerNode;
      if (node.dataset["target"] !== "print-only") continue;
      node.parentNode.removeChild(node);
    }
    deleted = true;
  });
})();
(function() {
  "use strict"
  // Replace <script> tags in slides area to make them executable
  var scripts = document.querySelectorAll(
    '.remark-slides-area .remark-slide-container script'
  );
  if (!scripts.length) return;
  for (var i = 0; i < scripts.length; i++) {
    var s = document.createElement('script');
    var code = document.createTextNode(scripts[i].textContent);
    s.appendChild(code);
    var scriptAttrs = scripts[i].attributes;
    for (var j = 0; j < scriptAttrs.length; j++) {
      s.setAttribute(scriptAttrs[j].name, scriptAttrs[j].value);
    }
    scripts[i].parentElement.replaceChild(s, scripts[i]);
  }
})();
(function() {
  var links = document.getElementsByTagName('a');
  for (var i = 0; i < links.length; i++) {
    if (/^(https?:)?\/\//.test(links[i].getAttribute('href'))) {
      links[i].target = '_blank';
    }
  }
})();</script>

<script>
slideshow._releaseMath = function(el) {
  var i, text, code, codes = el.getElementsByTagName('code');
  for (i = 0; i < codes.length;) {
    code = codes[i];
    if (code.parentNode.tagName !== 'PRE' && code.childElementCount === 0) {
      text = code.textContent;
      if (/^\\\((.|\s)+\\\)$/.test(text) || /^\\\[(.|\s)+\\\]$/.test(text) ||
          /^\$\$(.|\s)+\$\$$/.test(text) ||
          /^\\begin\{([^}]+)\}(.|\s)+\\end\{[^}]+\}$/.test(text)) {
        code.outerHTML = code.innerHTML;  // remove <code></code>
        continue;
      }
    }
    i++;
  }
};
slideshow._releaseMath(document);
</script>
<!-- dynamically load mathjax for compatibility with self-contained -->
<script>
(function () {
  var script = document.createElement('script');
  script.type = 'text/javascript';
  script.src  = 'https://mathjax.rstudio.com/latest/MathJax.js?config=TeX-MML-AM_CHTML';
  if (location.protocol !== 'file:' && /^https?:/.test(script.src))
    script.src  = script.src.replace(/^https?:/, '');
  document.getElementsByTagName('head')[0].appendChild(script);
})();
</script>
  </body>
</html>